DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and x16

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster


Alignment Length:360 Identity:102/360 - (28%)
Similarity:131/360 - (36%) Gaps:144/360 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKN---GYGFVEFEDYRDADDAVYELNGKELLGER 66
            :||||.|....|:.|||..|..||..|.:.|..   |:.|||||..|||.|||..|:|:.:.|.|
  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73

  Fly    67 VVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRV 131
            ..||.:.|            :|....|||||                                  
  Fly    74 ARVELSTG------------KYARSGGGGGG---------------------------------- 92

  Fly   132 SWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRGGR 196
                                                                          ||.
  Fly    93 --------------------------------------------------------------GGG 95

  Fly   197 SGGGGGSGRGRSRSSSSR--------------SRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSK 247
            .|||||.| ||.|....|              :|....|::|.||.|:|.|:|||.|:.|  |::
  Fly    96 GGGGGGLG-GRDRGGGGRGDDKCYECGGRGHFARHCRERKARQRRRSNSFSRSRSTSRRR--RTR 157

  Fly   248 SKSPVKSRSRS------RSRSNKSRDVSKSKSK--SHSRTRSRS------PKR--ERDSRSRSRS 296
            |||..:|||||      ||..:..||.:.|.|:  .|.|..|.:      |||  |.:...|.|.
  Fly   158 SKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRG 222

  Fly   297 VSKRESRSRSRSKSIHRDSRSRDRSASAENKSRSR 331
            ..:..|||||.|.::.|.|..|.|..|:.::|.||
  Fly   223 SPRSRSRSRSASPAVRRGSPPRRRGDSSASRSVSR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 32/71 (45%)
RRM2_SRSF4_like 120..191 CDD:241044 0/70 (0%)
x16NP_723226.1 RRM <1..>82 CDD:223796 33/84 (39%)
RRM_SRSF3_like 9..81 CDD:240819 32/71 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.