DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and Tia1

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006236890.1 Gene:Tia1 / 312510 RGDID:1305742 Length:387 Species:Rattus norvegicus


Alignment Length:195 Identity:47/195 - (24%)
Similarity:82/195 - (42%) Gaps:39/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILI-------KNGYGFVEFEDYRDADDAVYELNGKELL 63
            :|||.|...|.|..:.:.|...|..::..:       .:.|.||||.::|.|..|:..:||::::
  Rat     9 LYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDQTAGNDPYCFVEFHEHRHAAAALAAMNGRKIM 73

  Fly    64 GERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTE--YRLIVEN 126
            |:.|.|..|  |...|                       .|...|||......|::  :.:.|.:
  Rat    74 GKEVKVNWA--TTPSS-----------------------QKKDTSSSTVVSTQRSQDHFHVFVGD 113

  Fly   127 LSSRVSWQDLKDYMRQAGEVTYADAHK-----QRRNEGVVEFASLSDMKTAIEKLDDTELNGRRI 186
            ||..::.:|:|......|.::.|...|     :.:..|.|.|.:..|.:.||:::....|.||:|
  Rat   114 LSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQI 178

  Fly   187  186
              Rat   179  178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 22/74 (30%)
RRM2_SRSF4_like 120..191 CDD:241044 18/72 (25%)
Tia1XP_006236890.1 ELAV_HUD_SF 6..281 CDD:273741 47/195 (24%)
RRM_SF 8..82 CDD:302621 21/72 (29%)
RRM2_TIA1 106..185 CDD:241062 18/73 (25%)
RRM3_TIAR 215..287 CDD:241064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.