DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and Srsf5

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_038967784.1 Gene:Srsf5 / 29667 RGDID:3664 Length:270 Species:Rattus norvegicus


Alignment Length:313 Identity:177/313 - (56%)
Similarity:207/313 - (66%) Gaps:49/313 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGSRVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGE 65
            |.|.||::|.|....||:|:|||||||||.|||.:|.|:|||||||.||||||||||:||||..|
  Rat     1 MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSE 65

  Fly    66 RVVVEPARGTARGS-NRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSS 129
            ||.:|.||..:||. .|.||.||:..||             .|:..|..||:|||.|||||||||
  Rat    66 RVTIEHARARSRGGRGRGRYSDRFSSRR-------------PRNDRRNAPPVRTENRLIVENLSS 117

  Fly   130 RVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRG 194
            |||||||||:||||||||:||||:.:.|||||||||..|:|.|||||...|:|||:|.|:|    
  Rat   118 RVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIE---- 178

  Fly   195 GRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSR 259
                   ||.|        .||||||.|||:|.||.|||:||||      ||||.|  :||||||
  Rat   179 -------GSKR--------HSRSRSRSRSRTRSSSRSRSRSRSR------RSKSYS--RSRSRSR 220

  Fly   260 SRSNKSRDVSKSKSKSHSRTRSRSPKRERDSRSRS-RSVSKRESRSRSRSKSI 311
            ||       |||:|.|.|....:|.||...|||:| .||.::.|||||||:|:
  Rat   221 SR-------SKSRSGSRSPVPEKSQKRGSSSRSKSPASVDRQRSRSRSRSRSV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 47/68 (69%)
RRM2_SRSF4_like 120..191 CDD:241044 52/70 (74%)
Srsf5XP_038967784.1 RRM1_SRSF5 5..74 CDD:410008 47/68 (69%)
RRM2_SRSF5 99..179 CDD:410158 59/90 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I6994
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101955
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X517
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.