DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and drr-2

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_499818.1 Gene:drr-2 / 259546 WormBaseID:WBGene00011730 Length:207 Species:Caenorhabditis elegans


Alignment Length:296 Identity:64/296 - (21%)
Similarity:94/296 - (31%) Gaps:113/296 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIK--------------NGYGFVEFEDYRDADDAVY 55
            :.::|||||.....|:|...|....|.:.|.|              .|:.:|.||:.:..:.|:.
 Worm     7 KAFIGGLPYDSIATDIETILKHCKFTDEELKKFDIHLVHDRDSGSFKGFAYVTFENEQQMNTAIS 71

  Fly    56 ELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEY 120
            .|||.: .|.||:     ...|...|||.|  .||.|||.||.:.::....|.:..:        
 Worm    72 GLNGAD-FGNRVL-----KVNRAQQRDRSD--RGGGRGGRGGNFGDRGGRGRGAGGF-------- 120

  Fly   121 RLIVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRR 185
                                |:.||       ..|.|||                          
 Worm   121 --------------------RRGGE-------GGRFNEG-------------------------- 132

  Fly   186 IHLVEDRRGGRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKS 250
                 :||||..|||...|                  .|.||.|..:.|:...|      ..|..
 Worm   133 -----ERRGGFGGGGHRGG------------------YRQRRESEEQHKAEETS------DPSAP 168

  Fly   251 PV-KSRSRSRSRSNKSRDVSKSKSKSHSRTRSRSPK 285
            |. :.|...:.|:..:.::...|.:....|:.|..|
 Worm   169 PAERPRLNLKPRTTDAAEIEARKKQEEEETKRRQEK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 22/82 (27%)
RRM2_SRSF4_like 120..191 CDD:241044 7/70 (10%)
drr-2NP_499818.1 RRM_SF 6..88 CDD:388407 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.