DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and Tial1

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_033409.1 Gene:Tial1 / 21843 MGIID:107913 Length:392 Species:Mus musculus


Alignment Length:209 Identity:45/209 - (21%)
Similarity:79/209 - (37%) Gaps:62/209 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILI-----------------------KNGYGFVEFEDY 47
            :|||.|...|.|..:.:.|...|..:...:                       .:.|.||||.::
Mouse    11 LYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQPDSRRVNSSVGFSVLQHTSNDPYCFVEFYEH 75

  Fly    48 RDADDAVYELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRY 112
            |||..|:..:||:::||:.|.|..|  |...|.:                         :.:|.:
Mouse    76 RDAAAALAAMNGRKILGKEVKVNWA--TTPSSQK-------------------------KDTSNH 113

  Fly   113 GPPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAHK-----QRRNEGVVEFASLSDMKTA 172
                   :.:.|.:||..::.:|:|......|:::.|...|     :.:..|.|.|.:..|.:.|
Mouse   114 -------FHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENA 171

  Fly   173 IEKLDDTELNGRRI 186
            |..:....|.||:|
Mouse   172 IVHMGGQWLGGRQI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 24/90 (27%)
RRM2_SRSF4_like 120..191 CDD:241044 18/72 (25%)
Tial1NP_033409.1 RRM1_TIAR 10..107 CDD:410028 26/97 (27%)
RRM2_TIAR 113..192 CDD:410029 18/80 (23%)
RRM3_TIAR 222..294 CDD:241064
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..392
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.