DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and Snrnp70

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_033250.3 Gene:Snrnp70 / 20637 MGIID:98341 Length:448 Species:Mus musculus


Alignment Length:409 Identity:93/409 - (22%)
Similarity:128/409 - (31%) Gaps:157/409 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILI--------KNGYGFVEFEDYRDADDAVYELNGKEL 62
            ::|..:.|...|..|.|.|:.||..:.|.:        ..||.|:|:|..||...|....:||::
Mouse   105 LFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKI 169

  Fly    63 LGERVVVEPARG-TARGSNRDRYDDRYGGRRGGGGG---RYNEKNKNSRSSSRYGP-PLRTEYRL 122
            .|.||:|:..|| |.:|....|.....||.|.||..   |::.::..||...|.|| ||      
Mouse   170 DGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPL------ 228

  Fly   123 IVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIH 187
                                        .|:.                                 
Mouse   229 ----------------------------PHRD--------------------------------- 232

  Fly   188 LVEDRRGGRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPV 252
                             |.|.|....|.|||.|.:.|.||      :||||.:.|..||:.|.  
Mouse   233 -----------------RDRDRERERRERSRERDKERERR------RSRSRDRRRRSRSRDKD-- 272

  Fly   253 KSRSRSRSRS-NKSRDVSKSKSKSHSRTRSRSPKRER---------------------------- 288
             .|.|||.|| :|.||..:..|:|..|.|....::|.                            
Mouse   273 -ERRRSRERSKDKDRDRKRRSSRSRERARRERERKEELRGGGGGGGGGSGGGGGGDMAEPSEAGD 336

  Fly   289 -------------------DSRSRSRSVSKRESRSRSRSKSIHRDSRSRDRSASAENKSRSRSRS 334
                               :.:.|.|.   ||.|...||:...|..|.|||....:...|...|.
Mouse   337 GAPDDGPPGELGPEGPDGPEEKGRDRD---RERRRSHRSERERRRDRDRDRDREHKRGERGSERG 398

  Fly   335 RSASPKNGNASPDRNNESM 353
            |..:...|.:..|...|.:
Mouse   399 RDEARGGGGSGQDNGLEGL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 23/75 (31%)
RRM2_SRSF4_like 120..191 CDD:241044 1/70 (1%)
Snrnp70NP_033250.3 U1snRNP70_N 3..93 CDD:371969
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..79
Required for interaction with U1 RNA. /evidence=ECO:0000250|UniProtKB:P08621 92..202 31/96 (32%)
RRM_snRNP70 102..187 CDD:240682 26/81 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..439 66/327 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.