DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and rnp-1

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001256408.1 Gene:rnp-1 / 179672 WormBaseID:WBGene00004384 Length:305 Species:Caenorhabditis elegans


Alignment Length:74 Identity:20/74 - (27%)
Similarity:36/74 - (48%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVV 68
            |:::||.||..|....|::.|:.:.:..:..|...|.||..|: .|.|..:..|.|..:.|:.|.
 Worm     3 SKLFVGNLPDNVDSNKLKQVFQPFCKVTECDIVKNYAFVHIEE-DDVDPIITRLTGYTIDGKVVN 66

  Fly    69 VEPARGTAR 77
            ::.:....|
 Worm    67 IKKSTSKLR 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 18/68 (26%)
RRM2_SRSF4_like 120..191 CDD:241044
rnp-1NP_001256408.1 RRM <2..>83 CDD:223796 20/74 (27%)
RRM1_2_CoAA_like 4..68 CDD:240789 18/64 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.