DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and tiar-2

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_496718.1 Gene:tiar-2 / 174909 WormBaseID:WBGene00012904 Length:434 Species:Caenorhabditis elegans


Alignment Length:256 Identity:62/256 - (24%)
Similarity:101/256 - (39%) Gaps:60/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILI--------KNGYGFVEFEDYRDADDAVYELNGKEL 62
            |:||.|...:....|...|..:|...:..|        ..|||||.:....||:.|:.|:|| ..
 Worm   134 VFVGDLCSEIDSTKLREAFVKFGEVSEAKIIRDNNTNKGKGYGFVSYPRREDAERAIDEMNG-AW 197

  Fly    63 LGERVV------VEPARGTARGSNRDRYDDRYGGRRGGGGG---RYNEKNKNSRSSSRYGPPLRT 118
            ||.|.:      .:|.....||.:|       |.|||||||   ||:.:::.:.... :......
 Worm   198 LGRRTIRTNWATRKPDEDGERGGDR-------GDRRGGGGGGRDRYHNQSEKTYDEI-FNQAAAD 254

  Fly   119 EYRLIVENLSSRVSWQDLKDYMRQA----GEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDT 179
            ...:.|.|:::..     :|.:|:|    |.:......| .:....|:|.:......||.::::.
 Worm   255 NTSVYVGNIANLG-----EDEIRRAFDRFGPINEVRTFK-IQGYAFVKFETKESAARAIVQMNNA 313

  Fly   180 ELNGRRIHLVEDRRG-----------------------GRSGGGGGS-GRGRSRSSSSRSR 216
            ::.|:.:.....:.|                       |.||||||| |.|.|:.|:...|
 Worm   314 DIGGQIVRCSWGKSGDSGKPSERGSGGGGGSGNYGYGYGNSGGGGGSGGPGNSQFSNFNQR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 23/81 (28%)
RRM2_SRSF4_like 120..191 CDD:241044 12/74 (16%)
tiar-2NP_496718.1 RRM 36..321 CDD:223796 48/201 (24%)
RRM_SF 42..113 CDD:302621
RRM_SF 133..207 CDD:302621 22/73 (30%)
RRM3_TIA1_like 256..326 CDD:240800 12/75 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.