DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and egg-3

DIOPT Version :10

Sequence 1:NP_788671.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001369855.1 Gene:egg-3 / 174677 WormBaseID:WBGene00009701 Length:555 Species:Caenorhabditis elegans


Alignment Length:129 Identity:29/129 - (22%)
Similarity:42/129 - (32%) Gaps:39/129 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 NRDRYDDRYGGRRGG-------------------GGGRYNEKNKNSRSSSRYGPPLRTEYRLIV- 124
            |.|....|||....|                   ....:.: ||.|.....:| .|..|:..:| 
 Worm   113 NHDELAHRYGSSMAGWLRDRLVPSMSDCSSVLQRAAAEFYQ-NKMSDPLCNWG-QLNPEHVSMVA 175

  Fly   125 -------ENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTEL 181
                   |.:||:|.|..|.:..:.:..:|          |.|.||..|..|..:.|..|:..|
 Worm   176 ARIAKFSEEMSSKVKWSLLVEPGKFSCHLT----------EFVQEFNRLDRMFVSNELSDEESL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_788671.2 RRM1_SRSF4_like 5..74 CDD:409774
RRM2_SRSF4_like 120..191 CDD:410012 17/70 (24%)
egg-3NP_001369855.1 PTPc 207..513 CDD:214550 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.