DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and rsp-5

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_495307.3 Gene:rsp-5 / 174073 WormBaseID:WBGene00004702 Length:208 Species:Caenorhabditis elegans


Alignment Length:342 Identity:113/342 - (33%)
Similarity:146/342 - (42%) Gaps:141/342 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGE--RV 67
            |:|:|.:||..||||:|||.||||:..:|.:|.|:.||:|||.|||:||.::|:||.:.|.  |:
 Worm     3 RLYLGKIPYNARERDVERFLKGYGKINNISMKYGFAFVDFEDSRDAEDACHDLDGKTMEGSSMRL 67

  Fly    68 VVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVS 132
            |||.|||..||      :||:|.|                                         
 Worm    68 VVEMARGKPRG------NDRHGSR----------------------------------------- 85

  Fly   133 WQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRGGRS 197
                                                                             
 Worm    86 ----------------------------------------------------------------- 85

  Fly   198 GGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVK-SRSRSRSR 261
                 |.|.||||...|||:..|||||||....|| :|||||.||     |:|||: ||.||.||
 Worm    86 -----SPRRRSRSPRRRSRTPPRRRSRSRDRKRSR-RSRSRSSSR-----SRSPVRESRRRSESR 139

  Fly   262 S-NKSRDVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSKRESRSRSRSKSIHRDSRSRDRSASAE 325
            | :..||:.:..|      |||||...:| |||:||.|..:: ...|.:|:     ||.||.|.:
 Worm   140 SPSPKRDLKREAS------RSRSPLPAKD-RSRTRSGSPPKN-GGDRKRSV-----SRGRSHSRD 191

  Fly   326 NKSRSRSRSRS-ASPKN 341
            ..:||.|||.| .|||:
 Worm   192 GSNRSVSRSPSPGSPKD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 38/70 (54%)
RRM2_SRSF4_like 120..191 CDD:241044 0/70 (0%)
rsp-5NP_495307.3 RRM <3..>77 CDD:223796 40/73 (55%)
RRM_SF 3..74 CDD:302621 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1097
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.