DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and rbm-3.2

DIOPT Version :10

Sequence 1:NP_788671.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_493023.1 Gene:rbm-3.2 / 173071 WormBaseID:WBGene00011156 Length:85 Species:Caenorhabditis elegans


Alignment Length:81 Identity:26/81 - (32%)
Similarity:36/81 - (44%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGSRVYVGGLPYGVRERDLERFFKGYGRTRDILI--------KNGYGFVEFEDYRDADDAVYEL 57
            |.|..||||..|:...|.||..:|...|...::.|        ..|:.||||.:...|..||.:.
 Worm     1 MSGFSVYVGNAPFQTTEDDLGNYFSQAGNVSNVRIVCDRETGRPRGFAFVEFTEEAAAQRAVDQF 65

  Fly    58 NGKELLGERVVVEPAR 73
            ||.:..|..:.|..|:
 Worm    66 NGVDFNGRALRVNLAQ 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_788671.2 RRM1_SRSF4_like 5..74 CDD:409774 24/77 (31%)
RRM2_SRSF4_like 120..191 CDD:410012
rbm-3.2NP_493023.1 RRM 5..85 CDD:440488 24/77 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.