DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and SNRNP35

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_851030.1 Gene:SNRNP35 / 11066 HGNCID:30852 Length:251 Species:Homo sapiens


Alignment Length:334 Identity:65/334 - (19%)
Similarity:94/334 - (28%) Gaps:172/334 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYG------RTRDIL--IKNGYGFVEFED-------YRDADDAV- 54
            ::|..|....:|..|:..|..||      ..||::  ...||.|:|:::       |||||..| 
Human    58 LFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVI 122

  Fly    55 --------YELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSR 111
                    |||       ||        |.:|....|.....||::..|..|:..:::       
Human   123 DQHEIFVDYEL-------ER--------TLKGWIPRRLGGGLGGKKESGQLRFGGRDR------- 165

  Fly   112 YGPPLRTEYRL-IVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEK 175
               |.|....| :|:|        ||           |.:..::|                    
Human   166 ---PFRKPINLPVVKN--------DL-----------YREGKRER-------------------- 188

  Fly   176 LDDTELNGRRIHLVEDRRGGRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSK 240
                                                  |.|||||.|       |..|::|.|..
Human   189 --------------------------------------RERSRSRER-------HWDSRTRDRDH 208

  Fly   241 SRGGRSKSKSPVKSRSRSRSRSNKSRDVSKSKSKSHSRTRSRSPKR-------ERDSRSRSRSVS 298
            .| ||.|                              |.:.|.|.|       ||:...|...:.
Human   209 DR-GREK------------------------------RWQEREPTRVWPDNDWERERDFRDDRIK 242

  Fly   299 KRESRSRSR 307
            .||.:.|.:
Human   243 GREKKERGK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 24/91 (26%)
RRM2_SRSF4_like 120..191 CDD:241044 7/71 (10%)
SNRNP35NP_851030.1 RRM_snRNP35 53..142 CDD:240683 26/98 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.