DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and Srsf9

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_079849.1 Gene:Srsf9 / 108014 MGIID:104896 Length:222 Species:Mus musculus


Alignment Length:251 Identity:96/251 - (38%)
Similarity:125/251 - (49%) Gaps:65/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYG-----FVEFEDYRDADDAVYELNGKELLG 64
            |:|||.||..|||:|||..|..|||.|:|.:||.:|     ||.|||.|||:||:|..||.:...
Mouse    16 RIYVGNLPSDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQ 80

  Fly    65 ERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPL-RTEYRLIVENLS 128
            .|:.||             :...||||.|...|            :|.|||. |:::|::|..|.
Mouse    81 CRLRVE-------------FPRTYGGRGGWPRG------------ARNGPPTRRSDFRVLVSGLP 120

  Fly   129 SRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGR-------RI 186
            ...|||||||:||:||:|.|||.  |:...|:||:....||:.|:.|||||:....       |:
Mouse   121 PSGSWQDLKDHMREAGDVCYADV--QKDGMGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRV 183

  Fly   187 HLVEDRRGGRSGGGGGSGRGRSRSSS---SRSRSRSRRRS---RSRRSSHSRSKSR 236
            :                   ..||:|   |||||.||.|.   :||.|.|..|..|
Mouse   184 Y-------------------PERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFR 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 37/73 (51%)
RRM2_SRSF4_like 120..191 CDD:241044 31/77 (40%)
Srsf9NP_079849.1 RRM1_SRSF9 16..87 CDD:241042 37/83 (45%)
RRM2_SRSF9 112..187 CDD:241212 31/95 (33%)
Interaction with SAFB1. /evidence=ECO:0000250 189..201 6/11 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..222 15/31 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.