DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and hnrnpm

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_004911113.1 Gene:hnrnpm / 100489127 XenbaseID:XB-GENE-993962 Length:744 Species:Xenopus tropicalis


Alignment Length:140 Identity:45/140 - (32%)
Similarity:64/140 - (45%) Gaps:28/140 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GGGGRYNEKNKN-----SRSSSRYGP--PLRTEYRLIVENLSSRVSWQDLKDYMRQ-AGEVTYA- 149
            |.|.:.|:.:|.     .::::|:.|  |.| .||..:.|:...|.||.|||.::: .|||||. 
 Frog    41 GDGDQVNQNDKRKEKGMKKTTNRFEPYNPQR-RYRAFISNIPFDVKWQALKDLVKEKVGEVTYVE 104

  Fly   150 ---DAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRGGRS-------------- 197
               |...:.|....|||.....||.|::.|:...||||.:.:.||..|.||              
 Frog   105 LLMDDEGKSRGCAAVEFKLEDSMKKAVQVLNKHVLNGRPLKVREDPDGERSRRAAHSVFGPGPMG 169

  Fly   198 -GGGGGSGRG 206
             ||.|..|.|
 Frog   170 MGGPGPMGMG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783
RRM2_SRSF4_like 120..191 CDD:241044 27/75 (36%)
hnrnpmXP_004911113.1 HnRNP_M 48..72 CDD:371586 5/24 (21%)
RRM1_hnRNPM 74..149 CDD:241101 26/74 (35%)
PABP-1234 76..>388 CDD:130689 35/104 (34%)
RRM2_hnRNPM_like 245..318 CDD:240832
RRM3_hnRNPM 668..744 CDD:241105
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.