DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and PUB1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_014382.1 Gene:PUB1 / 855716 SGDID:S000004961 Length:453 Species:Saccharomyces cerevisiae


Alignment Length:305 Identity:65/305 - (21%)
Similarity:116/305 - (38%) Gaps:62/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEI-VQRARPH 95
            |.:::|.|....|.:.|:.:|...|.:|:..::.|. :|.:..:.||.|.......| :|.....
Yeast    75 RVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDK-NNKNVNYAFVEYHQSHDANIALQTLNGK 138

  Fly    96 TIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFG 160
            .|:|.||:...|...|                 ::...::..:|:|.|....|:..:|..|..|.
Yeast   139 QIENNIVKINWAFQSQ-----------------QSSSDDTFNLFVGDLNVNVDDETLRNAFKDFP 186

  Fly   161 PVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAP-----------RKHWILQTLVEVKRSTQK 214
            ...|..::.|.:||..|.:||:.|.....|:.|:..           |.:|      ..||....
Yeast   187 SYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINW------AAKRDNNN 245

  Fly   215 ADR-RFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSV-----------LPPSAFTNGW 267
            .:. :.|....::.|.|:        ..||.|| |.|..:..::           :|||:.  |.
Yeast   246 NNNYQQRRNYGNNNRGGF--------RQYNSNN-NNNMNMGMNMNMNMNMNNSRGMPPSSM--GM 299

  Fly   268 AHYVIPMAPKPTPGQNMAASLPSQ---QLAEHSLNGHGPDMWSSY 309
            ....:|:..:..|.|:....||.|   |..:|.:....|.:.::|
Yeast   300 PIGAMPLPSQGQPQQSQTIGLPPQVNPQAVDHIIRSAPPRVTTAY 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 19/77 (25%)
RRM2_hnRNPA_like 137..209 CDD:240774 19/82 (23%)
PUB1NP_014382.1 RRM1_PUB1 77..150 CDD:410026 18/73 (25%)
RRM2_PUB1 161..240 CDD:410031 19/84 (23%)
RRM3_PUB1 341..414 CDD:410033 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.