powered by:
Protein Alignment Rbp4 and ZCRB1
DIOPT Version :9
Sequence 1: | NP_476935.1 |
Gene: | Rbp4 / 41668 |
FlyBaseID: | FBgn0010258 |
Length: | 428 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_149105.3 |
Gene: | ZCRB1 / 85437 |
HGNCID: | 29620 |
Length: | 217 |
Species: | Homo sapiens |
Alignment Length: | 67 |
Identity: | 18/67 - (26%) |
Similarity: | 33/67 - (49%) |
Gaps: | 4/67 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTID 98
:::..|....|...|...||::|.|....:::|..:..|:|..|:.::|..|.:...|| |:
Human 12 VYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRA----IN 72
Fly 99 NK 100
||
Human 73 NK 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.