DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and HRP1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_014518.1 Gene:HRP1 / 853997 SGDID:S000005483 Length:534 Species:Saccharomyces cerevisiae


Alignment Length:289 Identity:75/289 - (25%)
Similarity:127/289 - (43%) Gaps:84/289 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97
            |:|||||:..||.:.||.:|.::|.|.|..:::||.:..||||||:::..|.||:.|.:.: |.:
Yeast   160 KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ-HIL 223

  Fly    98 DNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGL------KEYHDENIVREYF 156
            |.|:::.|.|:||.:..:.|                   :||:||:      ||:      .|:|
Yeast   224 DGKVIDPKRAIPRDEQDKTG-------------------KIFVGGIGPDVRPKEF------EEFF 263

  Fly   157 SQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRS-----TQKA- 215
            ||:|.:...:|::|::||:.|.|||:.:....:.::....:........:|:||:     .||: 
Yeast   264 SQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPRHMQQKSS 328

  Fly   216 -----------DRR---------FRFPIFSSVRAGYIP---PQPATADSYNYNNPNYNPYLAQS- 256
                       :||         |.....:.:..||.|   || |..|.|......|.....|: 
Yeast   329 NNGGNNGGNNMNRRGGNFGNQGDFNQMYQNPMMGGYNPMMNPQ-AMTDYYQKMQEYYQQMQKQTG 392

  Fly   257 ---------------------VLPPSAFT 264
                                 .:||:|.|
Yeast   393 MDYTQMYQQQMQQMAMMMPGFAMPPNAMT 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 31/76 (41%)
RRM2_hnRNPA_like 137..209 CDD:240774 20/77 (26%)
HRP1NP_014518.1 PABP-1234 <144..463 CDD:130689 75/289 (26%)
RRM1_Hrp1p 161..236 CDD:409991 30/75 (40%)
RRM2_Hrp1p 244..321 CDD:409767 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.