DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AT1G60000

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_176208.1 Gene:AT1G60000 / 842294 AraportID:AT1G60000 Length:258 Species:Arabidopsis thaliana


Alignment Length:204 Identity:43/204 - (21%)
Similarity:68/204 - (33%) Gaps:62/204 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KGDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTY 80
            |.||.:|:.:.......|::.|.|.......||......|.......||.:..:..||||.|||.
plant    69 KDDGASAVLDPPAAVNTKLYFGNLPYNVDSATLAQIIQDFANPELVEVLYNRDTGQSRGFAFVTM 133

  Fly    81 VDPKSVEIVQRARPHTIDN-----------KI--------------VETKHALPRQDFKRGGGVG 120
            .:.:...|:       |||           |:              .||:|              
plant   134 SNVEDCNII-------IDNLDGTEYLGRALKVNFADKPKPNKEPLYPETEH-------------- 177

  Fly   121 SVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFV 185
                            ::|:|.|........:...|.:.|.|...:::.|.:|||.|.:||:.:.
plant   178 ----------------KLFVGNLSWTVTSESLAGAFRECGDVVGARVVFDGDTGRSRGYGFVCYS 226

  Fly   186 DPSSAEKAL 194
            ..:..|.||
plant   227 SKAEMETAL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 23/101 (23%)
RRM2_hnRNPA_like 137..209 CDD:240774 16/58 (28%)
AT1G60000NP_176208.1 RRM_SF 86..165 CDD:418427 20/85 (24%)
RRM2_NsCP33_like 178..253 CDD:410187 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.