DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and PAB8

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001185184.1 Gene:PAB8 / 841399 AraportID:AT1G49760 Length:671 Species:Arabidopsis thaliana


Alignment Length:275 Identity:67/275 - (24%)
Similarity:113/275 - (41%) Gaps:29/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVD-PKSVEIVQRARPHTI 97
            :::..||...:.|.|...|.:||:....|::||. ...|:|||||.:.: ..:...|......|.
plant   226 VYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDG-EGKSKGFGFVNFENSDDAARAVDALNGKTF 289

  Fly    98 DN---------KIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVR 153
            |:         |..|.:..| :|.|::         |....|.......:::..|.|...::.:|
plant   290 DDKEWFVGKAQKKSERETEL-KQKFEQ---------SLKEAADKSQGSNLYVKNLDESVTDDKLR 344

  Fly   154 EYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTL-VEVKRSTQKADR 217
            |:|:.||.:.|.|::.| .:|..|..||:.|..|..|.:|:......::.|. :.|..:.:|.||
plant   345 EHFAPFGTITSCKVMRD-PSGVSRGSGFVAFSTPEEATRAITEMNGKMIVTKPLYVALAQRKEDR 408

  Fly   218 RFRFPI-FSSVRAGYIPPQPA-TADSYNYNNPNYNPYLAQSVLPPSAFTN---GWAHYVIP-MAP 276
            :.|... ||.:|...:||... ....|....|.....|.....||:....   |:...::| |.|
plant   409 KARLQAQFSQMRPVNMPPAVGPRMQMYPPGGPPMGQQLFYGQGPPAMIPQPGFGYQQQLVPGMRP 473

  Fly   277 KPTPGQNMAASLPSQ 291
            ..:|..|....:..|
plant   474 GGSPMPNFFMPMMQQ 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 22/85 (26%)
RRM2_hnRNPA_like 137..209 CDD:240774 19/72 (26%)
PAB8NP_001185184.1 PABP-1234 46..646 CDD:130689 67/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.