DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and PAB1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_174676.2 Gene:PAB1 / 840313 AraportID:AT1G34140 Length:407 Species:Arabidopsis thaliana


Alignment Length:309 Identity:75/309 - (24%)
Similarity:125/309 - (40%) Gaps:58/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPK-SVEIVQRARPHTI 97
            :::..|....|...|:..|.:||.:..|||::|. ...||.||||.:...: :|..:::.....:
plant   121 VYVKNLVETATDADLKRLFGEFGEITSAVVMKDG-EGKSRRFGFVNFEKAEAAVTAIEKMNGVVV 184

  Fly    98 DNKIVETKHALPR----QDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQ 158
            |.|.:....|..:    :|.|....:..::.......| ||   :::..|.:..|...:.|.||:
plant   185 DEKELHVGRAQRKTNRTEDLKAKFELEKIIRDMKTRKG-MN---LYVKNLDDSVDNTKLEELFSE 245

  Fly   159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL----------APRKHWILQTLVEVKRSTQ 213
            ||.:.|.|::: ...|..:..||:||.....|.||:          .|    |..:|.:.|.. .
plant   246 FGTITSCKVMV-HSNGISKGVGFVEFSTSEEASKAMLKMNGKMVGNKP----IYVSLAQCKEQ-H 304

  Fly   214 KADRRFRF----------PIFSSVRAGYIPPQPATADSYN--YNNPNYNPY-LAQSVLPPSAFTN 265
            |...:.:|          ||||.|.|      |||..|..  ....|:.|| :..|.:|.|....
plant   305 KLHLQTQFNNPPPSPHQQPIFSQVVA------PATMLSQQTPLRGYNFQPYSMCGSRMPNSCPPI 363

  Fly   266 GWAHYVIPMAPKPT-----PGQNMAASLPSQQLAEHSLNGHGPDMWSSY 309
            ...::::|...:||     |...:..|||...|.        |::|:.|
plant   364 SIPNFMVPQPFRPTLYPPAPLVGLYGSLPQPLLQ--------PNLWNPY 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 20/76 (26%)
RRM2_hnRNPA_like 137..209 CDD:240774 20/81 (25%)
PAB1NP_174676.2 RRM_SF <1..23 CDD:302621
RRM2_I_PABPs 29..105 CDD:240825
ELAV_HUD_SF 30..296 CDD:273741 44/184 (24%)
RRM3_I_PABPs 118..197 CDD:240826 20/76 (26%)
RRM4_I_PABPs 222..299 CDD:240827 23/85 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.