DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AT1G01080

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001030925.1 Gene:AT1G01080 / 839463 AraportID:AT1G01080 Length:294 Species:Arabidopsis thaliana


Alignment Length:182 Identity:42/182 - (23%)
Similarity:80/182 - (43%) Gaps:37/182 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFG-IVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIV------- 89
            ::::..:.....:..|...|..|| :::..||.|:|.:..|||.|:||.....|.:|.       
plant   109 ELYVCNIPRSYDIAQLLDMFQPFGTVISVEVVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGT 173

  Fly    90 ------QRARPHTID-----NKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGL 143
                  .|.| :::|     .:..|..::.|::...                 :.:..::::|.|
plant   174 EVGGREMRVR-YSVDMNPGTRRNPEVLNSTPKKILM-----------------YESQHKVYVGNL 220

  Fly   144 KEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA 195
            ..:...:.:|.:||:||.:.|.::|.||:|||.|.|.||.|......:.||:
plant   221 PWFTQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 20/95 (21%)
RRM2_hnRNPA_like 137..209 CDD:240774 21/59 (36%)
AT1G01080NP_001030925.1 RRM_SF 110..183 CDD:302621 17/72 (24%)
RRM 214..285 CDD:214636 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.