DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AT1G17640

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001319031.1 Gene:AT1G17640 / 838341 AraportID:AT1G17640 Length:369 Species:Arabidopsis thaliana


Alignment Length:324 Identity:89/324 - (27%)
Similarity:143/324 - (44%) Gaps:66/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97
            |:|:||:|.:||.||...:|.:||.|.|:|::.|.::.:.|||||||:.|....|.|.. ..|.|
plant    67 KLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLE-EDHVI 130

  Fly    98 DNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPV 162
            |::.|:.|..|||.|  :...:.:|          ..:::||:|||....:|:.::.||..:|.:
plant   131 DDRKVDLKRTLPRGD--KDTDIKAV----------SKTRKIFVGGLPPLLEEDELKNYFCVYGDI 183

  Fly   163 ASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRK-HWILQTLVEVKRSTQK---ADRRFRFPI 223
            ...:::.|..|||.|.|||:.|....|.::..:..| |.:....||:||:..|   .|..||   
plant   184 IEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPKRTGRDNSFR--- 245

  Fly   224 FSSVRAGYIPPQPATADSYN---------YNN----PNYNPYLAQSVLPPSAF------------ 263
             |...:|....:    |||:         |:.    ..|..|...|::.|:.|            
plant   246 -SYGASGKYDQE----DSYSGKANEDYSMYSGYGGYGGYGAYAGNSMVNPAGFYGYGGGYGYGYG 305

  Fly   264 -----------TNGWAH----YVIPMAPKPTPGQNMA-ASLPSQQLAEHSLNGHGPDMWSSYPK 311
                       ..|::|    |.:..|.....|::.. .:..|.....:..||.|||.:..|.|
plant   306 YGGQMFNMGYGAGGYSHMGSGYGVAAAAAYGGGKSHGNGNNGSSSGKGNGTNGSGPDRYHPYQK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 32/76 (42%)
RRM2_hnRNPA_like 137..209 CDD:240774 23/72 (32%)
AT1G17640NP_001319031.1 RRM_SF 68..138 CDD:418427 29/70 (41%)
RRM_SF 158..236 CDD:418427 25/77 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.