DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and RBP45A

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_568815.1 Gene:RBP45A / 835581 AraportID:AT5G54900 Length:387 Species:Arabidopsis thaliana


Alignment Length:278 Identity:74/278 - (26%)
Similarity:110/278 - (39%) Gaps:63/278 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQ-FGIVADAVVLRDPVSNHSRGFGFVTY 80
            |.|:...:.||.:|  .||:|.|:.:.|...|...|.. :|.|..|.|:.|..:..|:|:|||.:
plant   141 GAGEKRFQTEGPDH--TIFVGDLAPEVTDYMLSDTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRF 203

  Fly    81 VDPKSVEIVQRA-----------RPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMN 134
            .|...   ..||           ||..|..  ...|:|||.|........|:..|.     ...|
plant   204 ADENE---QMRAMTEMNGQYCSTRPMRIGP--AANKNALPMQPAMYQNTQGANAGD-----NDPN 258

  Fly   135 SKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKH 199
            :..||:|||.....::.::..|.|||.:..||:    ..|::  .||:::.:.:|||.||:    
plant   259 NTTIFVGGLDANVTDDELKSIFGQFGELLHVKI----PPGKR--CGFVQYANKASAEHALS---- 313

  Fly   200 WILQTLVEVKRSTQKADRRFRF-----PIFSSVRA-----GY--IPPQPATADSYNYNNPNYNPY 252
                    |...||...:..|.     |...|.:|     ||  .||||.....|....|..:  
plant   314 --------VLNGTQLGGQSIRLSWGRSPNKQSDQAQWNGGGYYGYPPQPQGGYGYAAQPPTQD-- 368

  Fly   253 LAQSVLPPSAFTNGWAHY 270
                   |:|:..|:..|
plant   369 -------PNAYYGGYTGY 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 26/88 (30%)
RRM2_hnRNPA_like 137..209 CDD:240774 19/71 (27%)
RBP45ANP_568815.1 RRM1_SECp43_like 61..138 CDD:409780
RRM2_SECp43_like 153..232 CDD:409781 24/85 (28%)
RRM3_NGR1_NAM8_like 259..330 CDD:409782 23/88 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.