DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AT5G53700

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_200181.2 Gene:AT5G53700 / 835451 AraportID:AT5G53700 Length:251 Species:Arabidopsis thaliana


Alignment Length:291 Identity:62/291 - (21%)
Similarity:90/291 - (30%) Gaps:103/291 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 ASVKLLMDRETGRQRAFG--FLEFVDPSSAE--KALAPRKHW-----ILQTLVEVKRSTQKADRR 218
            ::|:.|..::|..::.|.  .:|..|.|..|  ..||..||:     |:.  ::|.|..:|  |.
plant     4 SAVRGLESKDTNNRKCFSKISVEGYDTSVHEFPLKLALAKHFASCGKIVD--IDVPRDFKK--RI 64

  Fly   219 FRFPIFSSVRA--GYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPG 281
            .:.|:|....|  |..|...|...|                   .....||              
plant    65 LKSPLFIIFHAKEGESPVDKALELS-------------------GTDVGGW-------------- 96

  Fly   282 QNMAASLPSQQL-----------AEHSLNGHGPDMWSSYPKTGIY--------SAQEWTSSKVAE 327
            ..:..|||.||:           .|.:|.....|..|:..|..:.        |..|.|...|..
plant    97 NVVVKSLPGQQMYRDPGGVDRFKGERTLIVKVYDTPSTLSKIDLQIGLCKHFSSCGEVTGISVLV 161

  Fly   328 WGPKAGHKHAQTSTNDRAKIDLKELQAATFNNKLDFGARGDADRMSGAGLGLGLTGGAAVGVGAI 392
            .|....|:       .:|::|:.              .:|..|:      .|.|:|..|.|    
plant   162 HGNLCCHE-------SKARVDIM--------------GKGCVDK------ALELSGRTADG---- 195

  Fly   393 KKWPTQDYKVFKPA---KSPTNGVIPKIGKE 420
              |....|.|..||   ..||....|.||.|
plant   196 --WKIVVYFVVPPAGRKLKPTGSGHPTIGVE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621
RRM2_hnRNPA_like 137..209 CDD:240774 13/54 (24%)
AT5G53700NP_200181.2 RRM_SF 22..100 CDD:302621 22/114 (19%)
RRM_SF 123..200 CDD:302621 20/109 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.