DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AT5G51300

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001032055.1 Gene:AT5G51300 / 835204 AraportID:AT5G51300 Length:804 Species:Arabidopsis thaliana


Alignment Length:244 Identity:57/244 - (23%)
Similarity:85/244 - (34%) Gaps:52/244 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMN------SKRIFLGGL------KEYHDENI 151
            |.:.|....:|....|:...:....||.|....:.|      |....||..      |||.:.|:
plant   418 NFLAELGGTVPESSLKQSATLALGPGSSGSNPPWANNAGNGASAHPGLGSTPTKPPSKEYDETNL 482

  Fly   152 -------------VREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQ 203
                         :...||.||.:...|::.||.||..:.:||:::.|...|..|:.....:..:
plant   483 YIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAVQAMNGYRFE 547

  Fly   204 TLVEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAF----- 263
            ......|...|:......|       |...|||.|        ..|.|    |..||.|:     
plant   548 GRTLAVRIAGKSPPPIAPP-------GPPAPQPPT--------QGYPP----SNQPPGAYPSQQY 593

  Fly   264 -TNGWAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNG-HGPDMWSSYP 310
             |.|::...:|..| |.|..:..|..|....:.|.::| |.|.....||
plant   594 ATGGYSTAPVPWGP-PVPSYSPYALPPPPPGSYHPVHGQHMPPYGMQYP 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 2/10 (20%)
RRM2_hnRNPA_like 137..209 CDD:240774 20/90 (22%)
AT5G51300NP_001032055.1 SF1-HH 126..237 CDD:318504
SF1_like-KH 242..358 CDD:239088
AIR1 <363..405 CDD:331526
RRM_SF 480..556 CDD:327398 16/75 (21%)
RRM <481..673 CDD:330708 43/181 (24%)
Atrophin-1 <579..>791 CDD:331285 19/68 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.