DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and CP31B

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_199836.1 Gene:CP31B / 835090 AraportID:AT5G50250 Length:289 Species:Arabidopsis thaliana


Alignment Length:170 Identity:48/170 - (28%)
Similarity:76/170 - (44%) Gaps:24/170 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVE-IVQRARPHT 96
            |:|:|.|......:.|...|.|.|.|..:.|:.:..::.||||||||....:..| .|::.....
plant   114 KLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFE 178

  Fly    97 IDNKIVETKHALPRQDFKRGGGVGSVVGSFG------CEAGFMNSKRIFLGGLKEYHDENIVREY 155
            ::.:.:....|.||             ||..      .:|.|    ||::|.|....|...:...
plant   179 VNGRRLTVNRAAPR-------------GSRPERQPRVYDAAF----RIYVGNLPWDVDSGRLERL 226

  Fly   156 FSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA 195
            ||:.|.|...:::.||||||.|.|||::..:.:....|:|
plant   227 FSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 21/77 (27%)
RRM2_hnRNPA_like 137..209 CDD:240774 21/59 (36%)
CP31BNP_199836.1 RRM_SF 114..193 CDD:418427 23/91 (25%)
RRM2_NsCP33_like 208..283 CDD:410187 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.