DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Hnrnpab

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_006246407.1 Gene:Hnrnpab / 83498 RGDID:69255 Length:332 Species:Rattus norvegicus


Alignment Length:338 Identity:90/338 - (26%)
Similarity:141/338 - (41%) Gaps:76/338 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ASSACLGDCKGDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNH 71
            |.|......:||...|.|.|  |...|:|:||||..|:.:.|:.:|::||.|.|..:..||.:..
  Rat    52 APSGNQNGAEGDQINASKNE--EDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGR 114

  Fly    72 SRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALP-RQDFKRGGGVGSVVGSFGCEAGFMNS 135
            ||||||:.:.|..|||.|...:.|.:|.::::.|.|:. ::|                     ..
  Rat   115 SRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKD---------------------PV 158

  Fly   136 KRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHW 200
            |:||:|||.....|..:||||.|||.:.:::|.:|.:..::|.|.|:.|.:....:|.|..:.|.
  Rat   159 KKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHT 223

  Fly   201 ILQTLVEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTN 265
            :..:..|:|.:..|              ..|...|..:....|.|..|......||    .::..
  Rat   224 VSGSKCEIKVAQPK--------------EVYQQQQYGSGGRGNRNRGNRGSGGGQS----QSWNQ 270

  Fly   266 GWAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWS-SYPKTGIYSAQEWTSSKVAEWG 329
            |:.:|           .|.....  ||       |:||.... .|...|.|.           :|
  Rat   271 GYGNY-----------WNQGYGY--QQ-------GYGPGYGGYDYSPYGYYG-----------YG 304

  Fly   330 PKAGHKHAQTSTN 342
            |  |:.::|.|||
  Rat   305 P--GYDYSQGSTN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 30/77 (39%)
RRM2_hnRNPA_like 137..209 CDD:240774 23/71 (32%)
HnrnpabXP_006246407.1 CBFNT 1..75 CDD:311868 8/24 (33%)
RRM1_hnRNPAB 71..150 CDD:410151 31/80 (39%)
RRM2_hnRNPAB 155..234 CDD:409997 26/99 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.