DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AT5G47620

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001190485.1 Gene:AT5G47620 / 834812 AraportID:AT5G47620 Length:453 Species:Arabidopsis thaliana


Alignment Length:396 Identity:103/396 - (26%)
Similarity:158/396 - (39%) Gaps:114/396 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97
            |:||||:|.:|:.:.||.:|..||.|.:||:::|..:..:||||||.:.||...|.|...: |.|
plant     7 KLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLLK-HII 70

  Fly    98 DNKI----------------------VETKHALPRQD---FKRGGGVGSVVGSFGCEAGFMNSKR 137
            |.||                      ||.|.|:||.|   |.:..  .|:.||    .|..|||:
plant    71 DGKILVDSIVYNQLCRSDKCISLSEVVEAKKAVPRDDHVVFNKSN--SSLQGS----PGPSNSKK 129

  Fly   138 IFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWIL 202
            ||:|||.....|...::||:|||.:..|.::.|..|.|.|.|||:.:....:.:|.|....|.:.
plant   130 IFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELN 194

  Fly   203 QTLVEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPN-YNPYLAQSVLPPSAFTNG 266
            ..:||||.:                    :|...|.....|..|.| :......|:|  :.:|.|
plant   195 GKMVEVKLA--------------------VPKDMALNTMRNQMNVNSFGTSRISSLL--NEYTQG 237

  Fly   267 WAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHG--PDMWSSYPKTGIYSAQEWTSSKVAEWG 329
            ::         |:|                 ::|:|  |::                     .:.
plant   238 FS---------PSP-----------------ISGYGVKPEV---------------------RYS 255

  Fly   330 PKAGHKHAQTSTNDRAKIDLKELQAATFNNKLDFGARGDADRMSGAGLGLGL--------TGGAA 386
            |..|::...:.......|:|......|.|  ...|:.|...|....|....|        :|||:
plant   256 PAVGNRGGFSPFGHGYGIELNFEPNQTQN--YGSGSSGGFGRPFSPGYAASLGRFGSQMESGGAS 318

  Fly   387 VGVGAI 392
            ||.|::
plant   319 VGNGSV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 35/98 (36%)
RRM2_hnRNPA_like 137..209 CDD:240774 24/71 (34%)
AT5G47620NP_001190485.1 RRM_SF 8..73 CDD:302621 28/65 (43%)
RRM2_DAZAP1 126..205 CDD:240773 29/98 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.