DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AT5G19960

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_568388.1 Gene:AT5G19960 / 832118 AraportID:AT5G19960 Length:337 Species:Arabidopsis thaliana


Alignment Length:57 Identity:21/57 - (36%)
Similarity:34/57 - (59%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 IFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL 194
            :::|||.....|..||..||.:|.|.:||::.||.. |.:.:||:.|.:..||:.|:
plant     9 VYVGGLPYDITEEAVRRVFSIYGSVLTVKIVNDRSV-RGKCYGFVTFSNRRSADDAI 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621
RRM2_hnRNPA_like 137..209 CDD:240774 21/57 (37%)
AT5G19960NP_568388.1 RRM <4..158 CDD:223796 21/57 (37%)
RRM_SF 9..80 CDD:409669 21/57 (37%)
PRK12678 <103..>232 CDD:237171
Smc <228..>323 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.