DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and ATRBP45C

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_567764.1 Gene:ATRBP45C / 828808 AraportID:AT4G27000 Length:415 Species:Arabidopsis thaliana


Alignment Length:263 Identity:59/263 - (22%)
Similarity:107/263 - (40%) Gaps:54/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EGYEHLRKIFIGGLSTQTT----VETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVD-PKS 85
            ||.||  .:|:|.|:...|    .||.:..:|.   |..|.|:.|..:..|:|:|||.:.| .:.
plant   169 EGPEH--TVFVGDLAPDVTDHMLTETFKAVYSS---VKGAKVVNDRTTGRSKGYGFVRFADESEQ 228

  Fly    86 VEIVQRARPHTIDNKIVETKHALPRQDF-KRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDE 149
            :..:.........::.:.|..|..::.. .:.....:..|:.| |:...|: .||:|.:.:...|
plant   229 IRAMTEMNGQYCSSRPMRTGPAANKKPLTMQPASYQNTQGNSG-ESDPTNT-TIFVGAVDQSVTE 291

  Fly   150 NIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQK 214
            :.::..|.|||.:..||:    ..|::  .||:::.:.:.||:||:            |...||.
plant   292 DDLKSVFGQFGELVHVKI----PAGKR--CGFVQYANRACAEQALS------------VLNGTQL 338

  Fly   215 ADRRFRF-----PIFSSVR---------AGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTN 265
            ..:..|.     |.....:         .||....|...::|.|..|..:         |:|:..
plant   339 GGQSIRLSWGRSPSNKQTQPDQAQYGGGGGYYGYPPQGYEAYGYAPPPQD---------PNAYYG 394

  Fly   266 GWA 268
            |:|
plant   395 GYA 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 19/81 (23%)
RRM2_hnRNPA_like 137..209 CDD:240774 17/71 (24%)
ATRBP45CNP_567764.1 RRM1_SECp43_like 81..158 CDD:240790
ELAV_HUD_SF 91..346 CDD:273741 48/201 (24%)
RRM2_SECp43_like 172..251 CDD:240791 20/83 (24%)
RRM3_NGR1_NAM8_like 277..348 CDD:240792 22/89 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.