DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and FCA

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001319956.1 Gene:FCA / 827323 AraportID:AT4G16280 Length:747 Species:Arabidopsis thaliana


Alignment Length:336 Identity:89/336 - (26%)
Similarity:136/336 - (40%) Gaps:78/336 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97
            |:|:|.:....|.|.:|.:|.|.|.|.:..:::|..:...:|..||.|...|..:...||    :
plant   121 KLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRA----L 181

  Fly    98 DNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKR---------IFLGGLKEYHDENIVR 153
            .|:|     .||       ||.|.|      :..:.:.:|         :|:|.|.:...|..|.
plant   182 HNQI-----TLP-------GGTGPV------QVRYADGERERIGTLEFKLFVGSLNKQATEKEVE 228

  Fly   154 EYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA----------------PRKHWIL 202
            |.|.|||.|..|.|:.| |..:.|..||:::   ||.|.|:|                |    ::
plant   229 EIFLQFGHVEDVYLMRD-EYRQSRGCGFVKY---SSKETAMAAIDGLNGTYTMRGCNQP----LI 285

  Fly   203 QTLVEVKRSTQKADRRFRFPI--FSSVRAGYIPPQPAT--ADS---YNYNNPNYNPYLAQSVLPP 260
            ....|.||......|....|:  .|..|.....|:|.:  .||   .::.|| :.|..:::|.||
plant   286 VRFAEPKRPKPGESREMAPPVGLGSGPRFQASGPRPTSNFGDSSGDVSHTNP-WRPATSRNVGPP 349

  Fly   261 SAFTNGWAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWSSYPKTGIYSAQEWTSSKV 325
            |  ..|........:||  |||   |:|||.|  ...|.|:|....:..|..|:      :||..
plant   350 S--NTGIRGAGSDFSPK--PGQ---ATLPSNQ--GGPLGGYGVPPLNPLPVPGV------SSSAT 399

  Fly   326 AEWGPKAGHKH 336
            .:...:|..:|
plant   400 LQQQNRAAGQH 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 21/76 (28%)
RRM2_hnRNPA_like 137..209 CDD:240774 26/96 (27%)
FCANP_001319956.1 LSM_int_assoc <121..497 CDD:330438 89/336 (26%)
RRM1_FCA 121..200 CDD:241077 26/100 (26%)
RRM2_FCA 212..291 CDD:241081 24/86 (28%)
WW 597..624 CDD:238122
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.