DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AT4G09040

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_192643.2 Gene:AT4G09040 / 826483 AraportID:AT4G09040 Length:304 Species:Arabidopsis thaliana


Alignment Length:166 Identity:40/166 - (24%)
Similarity:64/166 - (38%) Gaps:36/166 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TTVETLRGFFSQFGIVADAVVLRDPVSNH----SRGFGFVTYVDP-------KSVEIVQ-RARPH 95
            :|.|.:|..|.::|.|.|.     .:|.|    :||..|:....|       ||:|..: ..|..
plant   105 STPEDIRSLFEKYGSVIDI-----EMSMHKKERNRGLVFIEMASPEEAATALKSLESCEYEGRRL 164

  Fly    96 TID-NKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYF-SQ 158
            .:| .|..:.|...||:       ..|.|.:|          .:|:..|........::|:| :.
plant   165 KVD
YAKTKKKKTYAPRE-------TPSPVPTF----------NLFVANLAFEARAKHLKEFFDAD 212

  Fly   159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL 194
            .|.|.|.:::......|...:||:.|.....||.||
plant   213 TGNVVSTEVIFHENPRRSSGYGFVSFKTKKQAEAAL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 20/79 (25%)
RRM2_hnRNPA_like 137..209 CDD:240774 15/59 (25%)
AT4G09040NP_192643.2 RRM_SF 100..167 CDD:409669 17/66 (26%)
RRM 190..263 CDD:214636 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.