DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and UBA2A

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001190109.1 Gene:UBA2A / 824853 AraportID:AT3G56860 Length:478 Species:Arabidopsis thaliana


Alignment Length:392 Identity:95/392 - (24%)
Similarity:142/392 - (36%) Gaps:108/392 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IKEEGYEHL----------------RKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNH 71
            :||...:|:                ||||:.||...|..|||...|.|:|.:.|...:.|.:|..
plant   115 LKEAAEKHVDVANRIREVADEDPVHRKIFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGK 179

  Fly    72 SRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNS- 135
            |:|:||:.|..........:.....|.:::...:.|.....|   ||......:....|...|| 
plant   180 SKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGPVF---GGAPIAAAAVSAPAQHSNSE 241

  Fly   136 ---KRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPR 197
               |:|::..:....|...:..:||:||.:....|.:|:.|||.:  ||..||..|| |.|    
plant   242 HTQKKIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPK--GFCLFVYKSS-ESA---- 299

  Fly   198 KHWILQTLVEVKRSTQKADRRFRFPIFSSVRA--GYIPPQPATADSYN-----YNNPNY------ 249
                       ||:.::..:.|...|....:|  |   |:|.....::     ||||.|      
plant   300 -----------KRALEEPHKTFEGHILHCQKAIDG---PKPGKQQQHHHNPHAYNNPRYQRNDNN 350

  Fly   250 --------------NPY-----LAQSVLPP--SAFTNGWAHYVIPMAPKPTPGQNMAASL----- 288
                          ||.     .||.:.|.  .|.|...|.....:|..|..||.:..||     
plant   351 GYGPPGGHGHLMAGNPAGMGGPTAQVINPAIGQALTALLASQGAGLAFNPAIGQALLGSLGTAAG 415

  Fly   289 -------------PSQQLAEHSLNGHG--PDMWSSY--PKTGIYSAQEWTS---SKVAEWG-PKA 332
                         .:|.:|..::.|:|  |.:...|  |:.|    |..||   ..|..:| |..
plant   416 VNPGNGVGMPTGYGTQAMAPGTMPGYGTQPGLQGGYQTPQPG----QGGTSRGQHGVGPYGTPYM 476

  Fly   333 GH 334
            ||
plant   477 GH 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 22/76 (29%)
RRM2_hnRNPA_like 137..209 CDD:240774 19/71 (27%)
UBA2ANP_001190109.1 PABP-1234 136..>347 CDD:130689 62/234 (26%)
RRM_SF 140..215 CDD:418427 22/74 (30%)
Med15 361..>465 CDD:312941 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.