Sequence 1: | NP_476935.1 | Gene: | Rbp4 / 41668 | FlyBaseID: | FBgn0010258 | Length: | 428 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001190079.1 | Gene: | CP29 / 824514 | AraportID: | AT3G53460 | Length: | 363 | Species: | Arabidopsis thaliana |
Alignment Length: | 253 | Identity: | 56/253 - (22%) |
---|---|---|---|
Similarity: | 87/253 - (34%) | Gaps: | 75/253 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 GDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYV 81
Fly 82 DPKSVEIVQR-----------------------------ARPHTID-----NKIVETKHALPRQ- 111
Fly 112 ----------DFKRGGGVGSV-VGSFGCE-----------------------------AGFMNSK 136
Fly 137 RIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rbp4 | NP_476935.1 | RRM_SF | 33..110 | CDD:302621 | 26/110 (24%) |
RRM2_hnRNPA_like | 137..209 | CDD:240774 | 16/58 (28%) | ||
CP29 | NP_001190079.1 | RRM_SF | 100..194 | CDD:302621 | 24/93 (26%) |
RRM_HP0827_like | 279..355 | CDD:240845 | 16/58 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1202220at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |