DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and CP29

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001190079.1 Gene:CP29 / 824514 AraportID:AT3G53460 Length:363 Species:Arabidopsis thaliana


Alignment Length:253 Identity:56/253 - (22%)
Similarity:87/253 - (34%) Gaps:75/253 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYV 81
            ||....::...:....|:|:|.||.......|...|...|.|....|:.|.|:..||||||||..
plant    84 GDDSAPVERNSFSPDLKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMS 148

  Fly    82 DPKSVEIVQR-----------------------------ARPHTID-----NKIVETKHALPRQ- 111
            ....||...:                             .||..::     .|..|:....||. 
plant   149 TAAEVEAAAQQFNGYVSRYLCSLLCLYLLIRVLCGLEFEGRPLRVNAGPPPPKREESFSRGPRSG 213

  Fly   112 ----------DFKRGGGVGSV-VGSFGCE-----------------------------AGFMNSK 136
                      ..:||||.||. .|.:|.|                             :|..:..
plant   214 GYGSERGGGYGSERGGGYGSERGGGYGSERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSGSGN 278

  Fly   137 RIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL 194
            |:::|.|....|:..:...|::.|.|...:::.||::||.:.|||:........:||:
plant   279 RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 26/110 (24%)
RRM2_hnRNPA_like 137..209 CDD:240774 16/58 (28%)
CP29NP_001190079.1 RRM_SF 100..194 CDD:302621 24/93 (26%)
RRM_HP0827_like 279..355 CDD:240845 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.