DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and CP33

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_190806.1 Gene:CP33 / 824403 AraportID:AT3G52380 Length:329 Species:Arabidopsis thaliana


Alignment Length:208 Identity:54/208 - (25%)
Similarity:85/208 - (40%) Gaps:49/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GDCKGDGKTAIKEE-------GYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSN 70
            ||   :|:..::||       |.|  .::::|.|....|...|...|.:.|.|.|..::.|.|::
plant    95 GD---EGEEEVEEEKQTTQASGEE--GRLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTD 154

  Fly    71 HSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSF-----GCEA 130
            .||||||||.                  ..|.|.|.|:...:..:.|| .:|..:|     |.|.
plant   155 RSRGFGFVTM------------------GSIEEAKEAMQMFNSSQIGG-RTVKVNFPEVPRGGEN 200

  Fly   131 GFMNSK-------------RIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFL 182
            ..|.:|             :::.|.|........:::.|.....|...|::.:|.|||.|.|||:
plant   201 EVMRTKIRDNNRSYVDSPHKVYAGNLGWNLTSQGLKDAFGDQPGVLGAKVIYERNTGRSRGFGFI 265

  Fly   183 EFVDPSSAEKALA 195
            .|....:.:.|||
plant   266 SFESAENVQSALA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 22/76 (29%)
RRM2_hnRNPA_like 137..209 CDD:240774 17/59 (29%)
CP33NP_190806.1 RRM_HP0827_like 117..193 CDD:240845 26/94 (28%)
RRM_SF 220..295 CDD:302621 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.