DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and NUC-L2

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_188491.1 Gene:NUC-L2 / 821392 AraportID:AT3G18610 Length:636 Species:Arabidopsis thaliana


Alignment Length:174 Identity:45/174 - (25%)
Similarity:73/174 - (41%) Gaps:29/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDP----KSVEI---V 89
            :.:|.|.||.|.....:..||.:.|.|.| |.|........:|:|.:.:..|    |::|:   :
plant   384 KTLFAGNLSYQIARSDIENFFKEAGEVVD-VRLSSFDDGSFKGYGHIEFASPEEAQKALEMNGKL 447

  Fly    90 QRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGG----LKEYHDEN 150
            ...|...:|   :..:...||.......|.||            .|:.|::.|    |.|...:.
plant   448 LLGRDVRLD---LANERGTPRNSNPGRKGEGS------------QSRTIYVRGFSSSLGEDEIKK 497

  Fly   151 IVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL 194
            .:|.:||:.|.|..|.:..|||||..|.|.:::..  |..::||
plant   498 ELRSHFSKCGEVTRVHVPTDRETGASRGFAYIDLT--SGFDEAL 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 19/83 (23%)
RRM2_hnRNPA_like 137..209 CDD:240774 20/62 (32%)
NUC-L2NP_188491.1 RRM1_NUCLs 385..461 CDD:409884 19/79 (24%)
RRM2_NUCLs 480..556 CDD:409885 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.