DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and U11/U12-31K

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_187651.1 Gene:U11/U12-31K / 820203 AraportID:AT3G10400 Length:261 Species:Arabidopsis thaliana


Alignment Length:254 Identity:52/254 - (20%)
Similarity:85/254 - (33%) Gaps:48/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 GGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFG 180
            |||.|.:..|         ...:::..|......:.:...||.||.||.|.:|.||.|.:.|...
plant    46 GGGSGGLAPS---------KSTLYVSNLDFSLTNSDIHTLFSTFGKVARVTVLKDRHTRQSRGVA 101

  Fly   181 FLEFVDPSSAEKALAPRKHWIL---QTLVEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADSY 242
            |:.:|....|.||.......||   :..|.:.....:|....:..::......|   :.......
plant   102 FVLYVSREDAAKAARSMDAKILNGRKLTVSIAADNGRASEFIKKRVYKDKSRCY---ECGDEGHL 163

  Fly   243 NYNNPNYNPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPGQ----NMAASLPSQQLAEHSLNGHGP 303
            :|..|...  |.....||.....|        ..|...|:    :.:|:.||..:||..      
plant   164 SYECPKNQ--LGPRERPPPPKKRG--------RRKEEEGEAEEISWSAAAPSLAVAEEE------ 212

  Fly   304 DMWSSYPKTGIYSAQEWTSSKVAEWGPKAGHKHAQTSTNDRAKIDLKELQAATFNNKLD 362
                       :..:.|.|....|.|.:...:.|:.....|.|  .||.:.:.|:::.|
plant   213 -----------FEEENWASVVDNEAGERLRKREAEEEEERRMK--RKEKKVSYFSDESD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621
RRM2_hnRNPA_like 137..209 CDD:240774 21/74 (28%)
U11/U12-31KNP_187651.1 RRM_ZCRB1 56..131 CDD:409827 20/74 (27%)
PTZ00368 154..>173 CDD:173561 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.