DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AT2G41060

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001078035.1 Gene:AT2G41060 / 818705 AraportID:AT2G41060 Length:451 Species:Arabidopsis thaliana


Alignment Length:287 Identity:66/287 - (22%)
Similarity:110/287 - (38%) Gaps:56/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVE 87
            :.:|...| ||||:.||...|..::|...|.|:|.:.|...:.|.||..|:|:||:.:.....  
plant   120 VADEDLVH-RKIFVHGLGWDTKADSLIDAFKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRSG-- 181

  Fly    88 IVQRARPHTIDNKIVETKHALPRQDFKRG--------GGVGSVVGS-FGCEAGFMN----SKRIF 139
                            .::||.:...|.|        ..:|.|.|: ....|...|    .::|:
plant   182 ----------------ARNALKQPQKKIGTRMTACQLASIGPVQGNPVVAPAQHFNPENVQRKIY 230

  Fly   140 LGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQT 204
            :..:....|...:.|:||:||.:....|.:|:.|||.:.|....:....||:|||          
plant   231 VSNVSADIDPQKLLEFFSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKKAL---------- 285

  Fly   205 LVEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTNGWAH 269
                    ::..:.|...:....:|...|.| .....:|:|:.|.|....::.........|..|
plant   286 --------EEPHKTFEGHVLHCHKANDGPKQ-VKQHQHNHNSHNQNSRYQRNDNNGYGAPGGHGH 341

  Fly   270 YV-----IPMAPKPTPGQNMAASLPSQ 291
            ::     ...|..|..||.:.|.|.||
plant   342 FIAGNNQAVQAFNPAIGQALTALLASQ 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 20/76 (26%)
RRM2_hnRNPA_like 137..209 CDD:240774 18/71 (25%)
AT2G41060NP_001078035.1 RRM_SF 128..203 CDD:302621 23/92 (25%)
RRM_RBM24_RBM38_like 227..302 CDD:240830 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.