DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AT2G37220

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_181259.1 Gene:AT2G37220 / 818299 AraportID:AT2G37220 Length:289 Species:Arabidopsis thaliana


Alignment Length:181 Identity:52/181 - (28%)
Similarity:83/181 - (45%) Gaps:11/181 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVE- 87
            ||:.:....|:|:|.|........|...|...|.|....|:.|.::..||||||||......|| 
plant    83 KEQSFSADLKLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEA 147

  Fly    88 IVQRARPHTIDNKIVETKHALP---RQD-FKRG-----GGVGSVVGSFGCEAGFMNSKRIFLGGL 143
            ..|:...:.:|.:.:......|   |:| |.||     |..||..|. |..:|..:..|:::|.|
plant   148 AAQQFNGYELDGRPLRVNAGPPPPKREDGFSRGPRSSFGSSGSGYGG-GGGSGAGSGNRVYVGNL 211

  Fly   144 KEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL 194
            ....|:..:...||:.|.|...:::.||::||.:.|||:.:......:.|:
plant   212 SWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 23/80 (29%)
RRM2_hnRNPA_like 137..209 CDD:240774 16/58 (28%)
AT2G37220NP_181259.1 RRM_SF 92..170 CDD:418427 22/77 (29%)
RRM2_NsCP33_like 205..280 CDD:410187 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.