DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and PAB7

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_181204.1 Gene:PAB7 / 818238 AraportID:AT2G36660 Length:609 Species:Arabidopsis thaliana


Alignment Length:342 Identity:71/342 - (20%)
Similarity:125/342 - (36%) Gaps:84/342 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIV 89
            ||.|.:|   ::..|....:.:.||..|::||.:....:.:|. :...||:.||.:.:|:..   
plant   197 EEKYTNL---YMKNLDADVSEDLLREKFAEFGKIVSLAIAKDE-NRLCRGYAFVNFDNPEDA--- 254

  Fly    90 QRARPHTID--------------NKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFL 140
             |....|::              .|..|.:..| |:.||.......::...         ..|::
plant   255 -RRAAETVNGTKFGSKCLYVGRAQKKAEREQLL-REQFKEKHEEQKMIAKV---------SNIYV 308

  Fly   141 GGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTL 205
            ..:.....|..:|::|||.|.:.|.||:.| |.|:.:.|||:.|   |:.|:|:...|.:..|..
plant   309 KNVNVAVTEEELRKHFSQCGTITSTKLMCD-EKGKSKGFGFVCF---STPEEAIDAVKTFHGQMF 369

  Fly   206 ----VEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTNG 266
                :.|..:.:|.||:.:.    .|:.|.......::.|.:.|...|.|..         :||.
plant   370 HGKPLYVAIAQKKEDRKMQL----QVQFGNRVEARKSSSSASVNPGTYAPLY---------YTNT 421

  Fly   267 WAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWSSYPKTGIYSAQEWTSSKVAEWGPK 331
            ....|....|......||                    :.||||           :|:...:.|.
plant   422 HPGMVYQSYPLMWKSANM--------------------IGSSYP-----------NSEAVTYPPM 455

  Fly   332 AGHKHAQTSTNDRAKID 348
            ..:..::...|...|:|
plant   456 VANAPSKNRQNRIGKLD 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 17/90 (19%)
RRM2_hnRNPA_like 137..209 CDD:240774 22/75 (29%)
PAB7NP_181204.1 PABP-1234 24..582 CDD:130689 71/342 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.