DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AT2G35410

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_181084.1 Gene:AT2G35410 / 818107 AraportID:AT2G35410 Length:308 Species:Arabidopsis thaliana


Alignment Length:189 Identity:42/189 - (22%)
Similarity:76/189 - (40%) Gaps:15/189 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DCKGDGKTAIKEEGYEH-----LRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSR 73
            :...|.:|:.:|:..|.     .||:|:..|....:|..:...|.|.|.|.:..::|.. ...:|
plant    72 ETSADEETSQEEKTEETQNSNLKRKLFVFNLPWSMSVNDISELFGQCGTVNNVEIIRQK-DGKNR 135

  Fly    74 GFGFVTYVDPKSVE-IVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKR 137
            ||.|||....:..: .:.:.....:..:|:....|   :.||:  ............|......:
plant   136 GFAFVTMASGEEAQAAIDKFDTFQVSGRIISVSFA---RRFKK--PTPKSPNDLPSPAPGDTRHK 195

  Fly   138 IFLGGLKEYHDENIVREYF--SQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL 194
            :::..|........:||.|  :.|.||::..:..|.| ||...:||:.|.....||.|:
plant   196 LYVSNLAWKARSTHLRELFTAADFNPVSARVVFADPE-GRSSGYGFVSFATREEAENAI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 17/77 (22%)
RRM2_hnRNPA_like 137..209 CDD:240774 17/60 (28%)
AT2G35410NP_181084.1 PABP-1234 97..>279 CDD:130689 36/164 (22%)
RRM_SF 97..168 CDD:409669 15/71 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.