DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AT2G22100

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_565526.1 Gene:AT2G22100 / 816745 AraportID:AT2G22100 Length:382 Species:Arabidopsis thaliana


Alignment Length:290 Identity:57/290 - (19%)
Similarity:89/290 - (30%) Gaps:99/290 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 NSKRIFLGGLK-EYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA-P 196
            :.:.||:.||. :...||: :..|..:|.:....::||::|||.:.|||:.|.....|..||. |
plant   161 SQRNIFVRGLGWDTTHENL-KAAFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNP 224

  Fly   197 RKHWILQTLVEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPS 261
            .|....:|:                        ..:|.:|     :|...|.......:||....
plant   225 EKRMYNRTV------------------------SCLPARP-----FNSGKPREQQQPVESVKIDL 260

  Fly   262 AFTNGWAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWSSYPKT-GIYSAQEWTSSKV 325
            :.|                |.....:||...|      |||.|......:. .:|:.|..     
plant   261 SHT----------------GNQSEMALPGIDL------GHGLDKGHQQQQNMSMYAGQNM----- 298

  Fly   326 AEWGPKAGHKHAQTSTNDRAKIDLKELQAATFNNKLDFGARGDADRMSGAGL------------- 377
                |..||.......|        .:..|...|.:..|.:.  .||.|:|:             
plant   299 ----PFYGHSQPPPGFN--------PMYGAMMGNPMVAGLQN--YRMFGSGMMNQGPMMPPNHMG 349

  Fly   378 ------------GLGLTGGAAVGVGAIKKW 395
                        |:|...||..|....:.|
plant   350 MVGQYVGDGNVNGVGAGAGAGAGFDGERAW 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621
RRM2_hnRNPA_like 137..209 CDD:240774 23/73 (32%)
AT2G22100NP_565526.1 PABP-1234 <164..>353 CDD:130689 51/259 (20%)
RRM_SF 165..235 CDD:418427 23/94 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.