DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and UBA1A

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_850021.1 Gene:UBA1A / 816744 AraportID:AT2G22090 Length:347 Species:Arabidopsis thaliana


Alignment Length:120 Identity:35/120 - (29%)
Similarity:52/120 - (43%) Gaps:9/120 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHT 96
            ||||:.||..:||.|||.|.|..:|.:.:..|:.|..:..::|||||.:...|..:...:.....
plant   104 RKIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKR 168

  Fly    97 IDNKIVETKHAL--PRQDFKRGGGVGSVVGSFGCEAGF-------MNSKRIFLGG 142
            |.|:....:.|.  |....|.....|.|..|.|..|..       :..:.:|.||
plant   169 ILNRTATCQLASMGPAASGKGHDQPGPVKISMGSMANHGQPQQQQVQGQHVFNGG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 24/78 (31%)
RRM2_hnRNPA_like 137..209 CDD:240774 3/6 (50%)
UBA1ANP_850021.1 RRM_SF 104..179 CDD:418427 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.