DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and emb2444

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_179441.1 Gene:emb2444 / 816366 AraportID:AT2G18510 Length:363 Species:Arabidopsis thaliana


Alignment Length:307 Identity:71/307 - (23%)
Similarity:115/307 - (37%) Gaps:94/307 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPK----SVEIVQRARP 94
            :::|||..|.:.|.|...|.|.|.|.:..|.:|.|:|..:.:||:.|...:    :::::...:.
plant    27 VYVGGLDAQLSEELLWELFVQAGPVVNVYVPKDRVTNLHQNYGFIEYRSEEDADYAIKVLNMIKL 91

  Fly    95 HTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQF 159
            |   .|.:....|  .|| |:...||:               .:|:|.|....||.::.:.||.|
plant    92 H---GKPIRVNKA--SQD-KKSLDVGA---------------NLFIGNLDPDVDEKLLYDTFSAF 135

  Fly   160 GPVAS-VKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKADRRFRFPI 223
            |.:|| .|::.|.:||..|.|||:.:....:::.|:                             
plant   136 GVIASNPKIMRDPDTGNSRGFGFISYDSFEASDAAI----------------------------- 171

  Fly   224 FSSVRAGYIPPQPATADSYNY-------------------NNP---NYNPYLAQSVLPPSA---- 262
             .|:...|:..:..|. ||.|                   .||   ...|:...::.|||:    
plant   172 -ESMTGQYLSNRQITV-SYAYKKDTKGERHGTPAERLLAATNPTAQKSRPHTLFAMGPPSSAPQV 234

  Fly   263 ------FTNGWAHYV---IPMAPKPTPGQNMAASLPS--QQLAEHSL 298
                  |.||....|   .|..|.|.|.|......||  .|..:||:
plant   235 NGLPRPFANGSMQPVPIPAPRQPPPPPPQVYQTQPPSWPSQPQQHSM 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 20/79 (25%)
RRM2_hnRNPA_like 137..209 CDD:240774 20/72 (28%)
emb2444NP_179441.1 RRM1_SF3B4 27..100 CDD:409771 19/75 (25%)
RRM2_SF3B4 111..193 CDD:409772 27/127 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.