DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and PABPC1L

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001359108.1 Gene:PABPC1L / 80336 HGNCID:15797 Length:619 Species:Homo sapiens


Alignment Length:311 Identity:78/311 - (25%)
Similarity:121/311 - (38%) Gaps:78/311 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTID 98
            |::..|......:.|:..|||||.:....|:||. |.|||.||||.:   :..|..|:|..|...
Human   193 IYVKNLPVDVDEQGLQDLFSQFGKMLSVKVMRDN-SGHSRCFGFVNF---EKHEEAQKAVVHMNG 253

  Fly    99 NKI-------------VETKHALPR------QD-FKRGGGVGSVVGSFGCEAGFMNSKRIFLGGL 143
            .::             ||.::.|.|      || .:|..||                 .:::..|
Human   254 KEVSGRLLYAGRAQKRVERQNELKRRFEQMKQDRLRRYQGV-----------------NLYVKNL 301

  Fly   144 KEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEK---------------- 192
            .:..|::.:|:.||.:|.:.|.|::  .|.|..:.|||:.|..|..|.|                
Human   302 DDSIDDDKLRKEFSPYGVITSAKVM--TEGGHSKGFGFVCFSSPEEATKAVTEMNGRIVGTKPLY 364

  Fly   193 -ALAPRKH---WILQTLVEVKRSTQKADRRFRFPIFSSVR---AGYIP--PQPATADSYNYNNPN 248
             |||.||.   .||......:.||.   |....|:..|.:   :.::|  |||....:| |....
Human   365 VALAQRKEERKAILTNQYMQRLSTM---RTLSNPLLGSFQQPSSYFLPAMPQPPAQAAY-YGCGP 425

  Fly   249 YNP------YLAQSVLPPSAFTNGWAHYVIPMAPKPTPGQNMAASLPSQQL 293
            ..|      :.:|...|.||:..|.:....|:.|:..|....:....|.|:
Human   426 VTPTQPAPRWTSQPPRPSSAYPPGASMVRPPVVPRRPPAHISSVRQASTQV 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 26/88 (30%)
RRM2_hnRNPA_like 137..209 CDD:240774 24/91 (26%)
PABPC1LNP_001359108.1 PABP-1234 11..606 CDD:130689 78/311 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.