DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Hnrnpd

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_077380.2 Gene:Hnrnpd / 79256 RGDID:620365 Length:353 Species:Rattus norvegicus


Alignment Length:328 Identity:92/328 - (28%)
Similarity:141/328 - (42%) Gaps:72/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVD 82
            :..||.:||.     |:||||||..||.:.|:.:||:||.|.|..:..||::..|||||||.:.:
  Rat    86 EAATAQREEW-----KMFIGGLSWDTTKKDLKDYFSKFGDVVDCTLKLDPITGRSRGFGFVLFKE 145

  Fly    83 PKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYH 147
            .:||:.|...:.|.::.|:::.|.|   :..|....|                |:||:|||....
  Rat   146 SESVDKVMDQKEHKLNGKVIDPKRA---KAMKTKEPV----------------KKIFVGGLSPDT 191

  Fly   148 DENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVK--- 209
            .|..:||||..||.|.|::|.||.:|.::|.|.|:.|.:....:|.:..:.|.:..:..|:|   
  Rat   192 PEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAM 256

  Fly   210 -----RSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTNGWAH 269
                 :..|:...|..|...:..|.|. |.|.......||.|..|..|...|        .|:..
  Rat   257 SKEQYQQQQQWGSRGGFAGRARGRGGG-PSQNWNQGYSNYWNQGYGSYGYNS--------QGYGG 312

  Fly   270 YVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWSSYPKTGIYSAQEWTSSKVAEWGPKAGH 334
            |                            .|:....::||...|.||.|:....||:..|   ||
  Rat   313 Y----------------------------GGYDYTGYNSYYGYGDYSNQQSGYGKVSRRG---GH 346

  Fly   335 KHA 337
            :::
  Rat   347 QNS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 32/76 (42%)
RRM2_hnRNPA_like 137..209 CDD:240774 25/71 (35%)
HnrnpdNP_077380.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 0/2 (0%)
CBFNT <55..76 CDD:285369
RRM1_hnRNPD_like 97..170 CDD:241019 30/72 (42%)
RRM2_hnRNPD 181..255 CDD:241027 26/73 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.