DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and hnrnpab

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_012814656.1 Gene:hnrnpab / 734098 XenbaseID:XB-GENE-6042555 Length:326 Species:Xenopus tropicalis


Alignment Length:316 Identity:84/316 - (26%)
Similarity:139/316 - (43%) Gaps:78/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97
            |:|:||||..|:.:.|:.:||:||.|:|..:..||.:..||||||:.:.|..||:.|...:.|.:
 Frog    66 KMFVGGLSWDTSKKDLKDYFSKFGEVSDCTIKMDPNTGRSRGFGFILFKDAASVDKVLEQKEHRL 130

  Fly    98 DNKIVETKHALP-RQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGP 161
            |.::::.|.|:. ::|                     ..|:||:|||.....|:.:||||..||.
 Frog   131 DGRLIDPKKAMAMKKD---------------------PIKKIFVGGLNPEAGEDKIREYFETFGE 174

  Fly   162 VASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKA--DRRF--RFP 222
            :.:::|.||.:|.::|.|.|:.|.:....:|.|..:.|.:..:..|:|.:..|.  .:::  |..
 Frog   175 IEAIELPMDPKTNKRRGFVFITFKEEEPVKKILEKKFHNVSGSKCEIKIAQPKEVYQQQYGGRGG 239

  Fly   223 IFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTN-GWAHYVIPMAPKPTPGQNMAA 286
            .|.. |.|    :...|...|:|. .||.|..|      .:.| |:..|                
 Frog   240 SFGG-RGG----RGGKAQGQNWNQ-GYNSYWNQ------GYGNQGYGGY---------------- 276

  Fly   287 SLPSQQLAEHSLNGHGPDMWSSYPKTGIYSAQEWTSSKVAEWGPKAGHKHAQTSTN 342
                   .:....|:|...:|.|   |.|.           :||  |:.::|.|.|
 Frog   277 -------GQQGYGGYGNYDYSGY---GYYG-----------YGP--GYDYSQGSAN 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 30/77 (39%)
RRM2_hnRNPA_like 137..209 CDD:240774 24/71 (34%)
hnrnpabXP_012814656.1 CBFNT 1..52 CDD:311868
RRM1_hnRNPAB 66..140 CDD:241201 29/73 (40%)
RRM2_hnRNPAB 145..224 CDD:241028 27/99 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.