DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Dazap1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001365924.1 Gene:Dazap1 / 70248 MGIID:1917498 Length:407 Species:Mus musculus


Alignment Length:290 Identity:95/290 - (32%)
Similarity:137/290 - (47%) Gaps:59/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQR 91
            |.:.:.|:|:|||...||.||||.:|||:|.|.|.|:::|..:|.|||||||.:.||..|..|..
Mouse     5 GADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLA 69

  Fly    92 ARPHTIDNKIVETKHALPR----------QDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEY 146
            :||||:|.:.::.|...||          :.:::|....|           ..|.:||:||:...
Mouse    70 SRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDS-----------SKSNKIFVGGIPHN 123

  Fly   147 HDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRS 211
            ..|..:||||.:||.|..|.::.|.|..|.|.|||:.|.|..|.::|:....|.|:...|||||:
Mouse   124 CGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRA 188

  Fly   212 TQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTNGWAHYVIPMAP 276
            ..:..:            ...|.||. |..:.            |.:.||| .||||.     .|
Mouse   189 EPRDSK------------NQAPGQPG-ASQWG------------SRVAPSA-ANGWAG-----QP 222

  Fly   277 KPTPGQNMAAS---LPSQQLAEHSLNGHGP 303
            .||..|.....   :|:.|    ::.|:||
Mouse   223 PPTWQQGYGPQGMWVPAGQ----AIGGYGP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 37/76 (49%)
RRM2_hnRNPA_like 137..209 CDD:240774 28/71 (39%)
Dazap1NP_001365924.1 RRM1_DAZAP1 11..92 CDD:409988 39/80 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..117 9/53 (17%)
RRM2_DAZAP1 111..190 CDD:409765 32/78 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.