DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and hnrnpd

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001025523.1 Gene:hnrnpd / 594903 XenbaseID:XB-GENE-988375 Length:295 Species:Xenopus tropicalis


Alignment Length:254 Identity:74/254 - (29%)
Similarity:118/254 - (46%) Gaps:41/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KGDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTY 80
            |.|.....::||     |:||||||..||.:.|:.:||:||.|.|..:..||::..|||||||.:
 Frog    27 KIDASKTEEDEG-----KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLF 86

  Fly    81 VDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKE 145
            .:.:.|:.|...:.|.::.|:::.|.|   :..|....|                |:||:|||..
 Frog    87 KESEGVDKVMEQKEHKLNGKVIDPKRA---KAMKTKEPV----------------KKIFVGGLSP 132

  Fly   146 YHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKR 210
            ...|..:||||..||.:.:::|.||.:|.::|.|.|:.|.:....:|.:..:.|.:..:..|:|.
 Frog   133 DTPEEKIREYFGTFGEIEAIELPMDNKTNKRRGFCFITFKEEDPVKKIMEKKYHNVGLSKCEIKV 197

  Fly   211 STQK-----------------ADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPY 252
            :..|                 :..|.|..:..:...||......:..||.|||..|..|
 Frog   198 ALSKEQYQQQQQWGTRGGGSSSRPRGRGGVSQTWSQGYSNYWNPSYSSYGYNNQGYGGY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 31/76 (41%)
RRM2_hnRNPA_like 137..209 CDD:240774 23/71 (32%)
hnrnpdNP_001025523.1 RRM1_hnRNPD 40..113 CDD:241200 29/72 (40%)
RRM2_hnRNPD 124..198 CDD:241027 24/73 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.