DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Rbm38

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_062420.2 Gene:Rbm38 / 56190 MGIID:1889294 Length:237 Species:Mus musculus


Alignment Length:263 Identity:66/263 - (25%)
Similarity:98/263 - (37%) Gaps:81/263 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97
            |||:|||...||..:||.:|..||.:.:|||:.|..:..|||:||||..|..:.:     |....
Mouse    33 KIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAD-----RACKD 92

  Fly    98 DNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPV 162
            .|.|::.:.|                          |....:||          .:....|.|..
Mouse    93 PNPIIDGRKA--------------------------NVNLAYLG----------AKPRSLQTGFA 121

  Fly   163 ASVKLLMDRETGRQRAFGFL-EFVDPSSAEKALAPRKHWILQTLVEVKRSTQKADRRFRFPIFSS 226
            ..|:.|  ..|..||.:|.. .::.|.:           |:|..|.:..:.        .|..||
Mouse   122 VGVQQL--HPTLIQRTYGLTPHYIYPPA-----------IVQPSVVIPATP--------VPSLSS 165

  Fly   227 VRAGYIPPQPATADSYNYNNPNYN--PYLAQSVLPPSAFTN--GWAHYVIPMAPKPTPGQNMAAS 287
            ....|.|..||.|   .|....|:  ||.|.    |:|.|:  |:.:      |...| |.::|:
Mouse   166 PYLEYTPASPAYA---QYPPATYDQYPYAAS----PAAATSFVGYGY------PAAVP-QALSAA 216

  Fly   288 LPS 290
            .|:
Mouse   217 APA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 29/76 (38%)
RRM2_hnRNPA_like 137..209 CDD:240774 14/72 (19%)
Rbm38NP_062420.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
RRM_RBM24_RBM38_like 32..107 CDD:240830 30/104 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.